PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G145100.2.p
Common NameSb03g012550, SORBIDRAFT_03g012550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 362aa    MW: 39212.2 Da    PI: 4.3798
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G145100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.24e-181461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +grWT+eEde+l++++k++G g+W++ ++  g+ R++k+c++rw +yl
  Sobic.003G145100.2.p 14 KGRWTKEEDEILARYIKEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                          79******************************99************97 PP

2Myb_DNA-binding55.61.2e-1767112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+ T+eE+e ++++++ lG++ W++Ia +++ gRt++++k++w+++l
  Sobic.003G145100.2.p  67 RGNITEEEEEMIIKLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                           7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.718961IPR017930Myb domain
SuperFamilySSF466891.31E-2911108IPR009057Homeodomain-like
SMARTSM007171.0E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-161461IPR001005SANT/Myb domain
CDDcd001674.09E-121661No hitNo description
PROSITE profilePS5129425.76562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2565115IPR009057Homeodomain-like
SMARTSM007172.1E-1766114IPR001005SANT/Myb domain
PfamPF002499.8E-1667112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTKE EDEILARYIK EHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI TEEEEEMIIK LHATLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRRATDFH  120
DGVVVNIDLS KLPGGGKRRG GRASRGIVAA AAKEKKAKGK AKEKDDKGKN KVAAEAEQQQ  180
QLKDDKEEEE DDDANVSTTP RPPQSDCAAA AAQSEEQAQA SASGLTSDNG PEEEEEEDTL  240
ALSEELVSAL LASPGSPKLE VGPDGSCMDS DSGPSGDSCG GPGGGPYGDV AQDLDLDDNA  300
IMDWDLMGLD ISAADDMWDP LMWDYDDQTL GVPEPEGGGV GHHQQPQQDE VMSDLFFLDN  360
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794110.0HF679411.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB5 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455521.10.0hypothetical protein SORBIDRAFT_03g012550
TrEMBLC5XI710.0C5XI71_SORBI; Putative uncharacterized protein Sb03g012550
STRINGSb03g012550.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-70myb domain protein 12